PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00056.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 361aa    MW: 40731.1 Da    PI: 6.0827
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00056.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WTteEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
  Rsa1.0_00056.1_g00008.1 14 KGAWTTEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding48.12.7e-1567112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
  Rsa1.0_00056.1_g00008.1  67 RGEFSSEEEQIIIMLHASRGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                              899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.197965IPR017930Myb domain
SuperFamilySSF466891.44E-2812108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-171461IPR001005SANT/Myb domain
CDDcd001674.67E-111661No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.75366116IPR017930Myb domain
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002491.3E-1367112IPR001005SANT/Myb domain
CDDcd001673.03E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MSRKPCCVGE ALKKGAWTTE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPEVKRGEF SSEEEQIIIM LHASRGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIEQG  120
IDPVTHKPLA SNTNPTVPEN LHSLDASSSD KQYSRSSSMP SMSRPPSSGL NTVSETTSKD  180
GTPVHEDGSL TPKKRLKKSC STSRLLNKVA AKATSMKEVL SASMEGSLSA NTSFSNGFFE  240
QVRNEEDNSN ASLINTIVEF DPFLQTTFYP EHEMNTTSDL GIDQDCFSHF LENFGRDDHN  300
EEHNMNHNYG HDLLMSDVSQ EVSSTSVDDQ DNPIEGWSNY LLDHADFIYD TDSDSLGNHF  360
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7026930.0AB702693.1 Brassica oleracea var. viridis mRNA for Myb domain protein 28-2 (BoMyb28-2), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111992.10.0PREDICTED: transcription factor MYB28-like
SwissprotQ9SPG20.0MYB28_ARATH; Transcription factor MYB28
TrEMBLC5HYG00.0C5HYG0_BRARP; MYB domain protein 28-2
STRINGBra035929.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.20.0myb domain protein 28